LL 37 is a synthetic cationic antimicrobial peptide corresponding to the active C terminal fragment of the human cathelicidin precursor, investigated for its broad spectrum antimicrobial and immunomodulatory properties in preclinical models.
Molecular Composition and Mechanistic Profile
Peptide identity: LL 37 is a 37 amino acid amphipathic peptide with the sequence [LL-37, 37 aa]
Origin: Derived from proteolytic cleavage of the 18 kDa cathelicidin precursor hCAP18.
Mechanistically, LL 37 has been associated with:
Direct membrane disruption of microbial cells through electrostatic interactions with anionic lipid components followed by pore formation or membrane solubilization in experimental systems.
Modulation of host immune signaling including chemotaxis and cytokine regulation in cell culture models.
Anti biofilm activity against various bacterial species observed in vitro.
These properties position LL 37 as a tool for studying innate immune peptide functions and microbial membrane interactions.
Integrated Research Applications
LL 37 is examined across microbial and immune related systems. Representative domains include:
Antimicrobial activity models: Investigation of bactericidal fungicidal and antiviral effects against Gram positive Gram negative and other pathogens in culture based assays.
Biofilm disruption studies: Evaluation of prevention and eradication of preformed biofilms in laboratory settings.
Immunomodulatory research: Assessment of effects on immune cell migration adhesion and inflammatory mediator production in experimental preparations.
Wound and tissue models: Use as a probe for epithelial repair signaling and host defense mechanisms in controlled animal systems.
Overall, LL 37 serves as a research tool for exploring cationic peptide mediated microbial control and immune coordination.
Analytical Validation, Formulation, and Storage
NextGenPeps supplies LL 37 as a high purity research peptide. Typical quality and handling features include:
Purity: ≥99% verified by HPLC.
Formulation: White lyophilized powder in sealed glass vials, intended for reconstitution with appropriate research grade solvent for experimental use only. No dosing guidance is provided for any organism.
Storage: Keep lyophilized material in a cool dark dry environment; long term storage at or below −20 °C. Store reconstituted solutions refrigerated, minimize freeze thaw cycles, and use within laboratory defined stability windows.
These conditions support structural integrity and reproducible experimental outcomes.
NextGenPeps supplies LL 37 as a high purity research peptide intended strictly for controlled laboratory use in vitro or in established animal models, such as murine systems. This compound is not approved as a drug, diagnostic, or dietary ingredient, and is not manufactured, packaged, or marketed for human consumption, self experimentation, clinical application, or any use outside properly designed and ethically approved research protocols.
