Spend $150 for Free Shipping!Shop Now
Next Gen Peptides LL-37 product image 1

LL-37 Peptide

Size:

Price:

$68.00$54.00

Out of Stock

Enter your email and we'll notify you when this item is back in stock.

Bulk Options:

Visa
Mastercard
American Express
Discover
PayPal
Venmo
Apple Pay

Similar Products

Product information

LL 37 is a synthetic cationic antimicrobial peptide corresponding to the active C terminal fragment of the human cathelicidin precursor, investigated for its broad spectrum antimicrobial and immunomodulatory properties in preclinical models.

Molecular Composition and Mechanistic Profile

  • Peptide identity: LL 37 is a 37 amino acid amphipathic peptide with the sequence [LL-37, 37 aa]

  • Origin: Derived from proteolytic cleavage of the 18 kDa cathelicidin precursor hCAP18.

  • Mechanistically, LL 37 has been associated with:

    • Direct membrane disruption of microbial cells through electrostatic interactions with anionic lipid components followed by pore formation or membrane solubilization in experimental systems.

    • Modulation of host immune signaling including chemotaxis and cytokine regulation in cell culture models.

    • Anti biofilm activity against various bacterial species observed in vitro.

These properties position LL 37 as a tool for studying innate immune peptide functions and microbial membrane interactions.

Integrated Research Applications

LL 37 is examined across microbial and immune related systems. Representative domains include:

  • Antimicrobial activity models: Investigation of bactericidal fungicidal and antiviral effects against Gram positive Gram negative and other pathogens in culture based assays.

  • Biofilm disruption studies: Evaluation of prevention and eradication of preformed biofilms in laboratory settings.

  • Immunomodulatory research: Assessment of effects on immune cell migration adhesion and inflammatory mediator production in experimental preparations.

  • Wound and tissue models: Use as a probe for epithelial repair signaling and host defense mechanisms in controlled animal systems.

Overall, LL 37 serves as a research tool for exploring cationic peptide mediated microbial control and immune coordination.

Analytical Validation, Formulation, and Storage

NextGenPeps supplies LL 37 as a high purity research peptide. Typical quality and handling features include:

  • Purity: ≥99% verified by HPLC.

  • Formulation: White lyophilized powder in sealed glass vials, intended for reconstitution with appropriate research grade solvent for experimental use only. No dosing guidance is provided for any organism.

  • Storage: Keep lyophilized material in a cool dark dry environment; long term storage at or below −20 °C. Store reconstituted solutions refrigerated, minimize freeze thaw cycles, and use within laboratory defined stability windows.

These conditions support structural integrity and reproducible experimental outcomes.

NextGenPeps supplies LL 37 as a high purity research peptide intended strictly for controlled laboratory use in vitro or in established animal models, such as murine systems. This compound is not approved as a drug, diagnostic, or dietary ingredient, and is not manufactured, packaged, or marketed for human consumption, self experimentation, clinical application, or any use outside properly designed and ethically approved research protocols.

Chemical Properties

Molecular FormulaC₂₀₅H₃₄₀N₆₀O₅₃
Molecular Weight4493.33
Monoisotopic Mass4490.55
Heavy Atom Count318

Common Research Questions

What is LL-37?

LL-37 is a natural peptide made by the body, and it's the only member of a peptide family called cathelicidins that humans produce. It's made of 37 amino acids, cut from a larger precursor protein called hCAP18, and it gets its name from starting with two leucine amino acids in a row (hence "LL").

How does LL-37 work?

LL-37's best known job is fighting off pathogens directly. It acts as a broad-spectrum antimicrobial, meaning it can kill or neutralize a wide range of bacteria, both gram-positive and gram-negative, along with some viruses and fungi. It does this partly through direct means and partly by defusing threats before they cause damage. It's able to bind directly to LPS, a toxic molecule found on the surface of certain bacteria, essentially neutralizing part of what makes those bacteria harmful.

What is the closest peptide to LL-37?

The closest comparison is CRAMP, since CRAMP is the mouse version of the same peptide family, essentially the rodent equivalent of LL-37, and it's used heavily in animal studies precisely because mice don't produce LL-37 themselves.

Frequently Asked Questions

How is LL-37 packaged?

LL-37 is supplied in the product format and quantity shown for the selected variant. Please inspect the sealed package when it arrives and contact support promptly if the package or labeling appears damaged.

How is LL-37 shipped?

Orders are shipped within the United States via USPS. Transit times are typically 3–7 business days, depending on destination and carrier conditions. Tracking information is provided when available.

How should LL-37 be stored?

Storage requirements are product-specific. Keep LL-37 in its original labeled container and follow the product documentation or manufacturer instructions supplied with the order. Contact support if the applicable storage guidance is not available.

What is the refund policy for LL-37?

Due to the nature of research materials, NextGenPeps orders are final and are not eligible for refunds, returns, or exchanges. Review the shipping and reship policies before ordering.

Is LL-37 intended for human use?

No. NextGenPeps materials are supplied strictly for laboratory research and development use and are not intended for human or animal consumption, clinical use, diagnostic use, cosmetic use, or dietary use.

Customer Reviews

No reviews yet.